SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087X271 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087X271
Domain Number 1 Region: 5-179
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.83e-49
Family Calponin-homology domain, CH-domain 0.0000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087X271
Sequence length 179
Comment (tr|A0A087X271|A0A087X271_HUMAN) Calponin {ECO:0000256|RuleBase:RU361224} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CNN2 OC=Catarrhini; Hominidae; Homo.
Sequence
MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTIL
CTLMNKLQPGSVPKINRSMQNWHQLENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQV
QAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQMGTNKCASQSGMTAYGTRR
Download sequence
Identical sequences A0A087X271 A0A2J8J2D0 A0A2J8R9Y8
ENSP00000484749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]