SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087X351 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087X351
Domain Number 1 Region: 20-144
Classification Level Classification E-value
Superfamily C-type lectin-like 1.67e-27
Family C-type lectin domain 0.00075
Further Details:      
 
Domain Number 2 Region: 147-245
Classification Level Classification E-value
Superfamily C-type lectin-like 3.71e-20
Family C-type lectin domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087X351
Sequence length 246
Comment (tr|A0A087X351|A0A087X351_POEFO) Uncharacterized protein {ECO:0000313|Ensembl:ENSPFOP00000000204} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MQWSLILLFLMAQCCFIDCQLYQFHYINENKNWTEAQQYCREKHTDLVTVTNMKDMKRLI
NISAGDQREAWIGLNDQKHGNRTWRWSLPGVEFNESETTWDTNEPNDGGSQVIYQNCVIV
NKYLKWTDDQCQTLRHFLCYNETNTTHKYHLIKEEKSWQEAQSYCRENHTDLISGTKQLQ
DEEVKKLMNSTSDHTYIGLFRDTWRWSDGSSFSFRHWNPIFNNHNPNSGQCAMTKFDGEG
RWTNVN
Download sequence
Identical sequences A0A087X351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]