SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087X369 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087X369
Domain Number 1 Region: 1156-1227
Classification Level Classification E-value
Superfamily Immunoglobulin 6.34e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 887-956
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000448
Family I set domains 0.046
Further Details:      
 
Domain Number 3 Region: 531-586
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000458
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 435-492
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000353
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 5 Region: 729-786
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000876
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 1493-1550
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000101
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 7 Region: 664-701
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000497
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 8 Region: 380-440
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000523
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 9 Region: 34-82
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000641
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 10 Region: 785-847
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000432
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 11 Region: 298-362
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000101
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 12 Region: 1612-1668
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000262
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087X369
Sequence length 1705
Comment (tr|A0A087X369|A0A087X369_POEFO) ADAMTS like 1 {ECO:0000313|Ensembl:ENSPFOP00000000222} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN=ADAMTSL1 OC=Poeciliinae; Poecilia.
Sequence
VKGCERDVSDDLLMHKLFSGVQSSRTARSEEDRDTLWDAWGSWSECSRTCGGGASYSLRR
CLSSRTCEGQNIKYRTCSNVDCPPDVGDFRAQQCSAHADVRHQGQFHDWLPVYNDPENPC
SLKCKAKGSGFMVELAPKVLDGTRCYTESLDMCISGVCQIVGCDHELGSTAKEDNCGICN
GDGSSCRLVRGHYKSQHTSGPTQAEDTVVVVPYQSRHVRLVLKGPDHLYVEAKTLLGEKT
ELMLDQSGQYYLENTTLDFQKLSDKEILRMTGPLGADFTVKIQLTGVADSGIQYIYYQPI
IHRWRETDFFPCSVTCGGGYQLTSAECYDLRAGRVVVDQYCHYYPENVKPKPKLQECNME
PCLDSDGYKEIMPYDLYHPLPRWESSPWTACSTSCGGGIQSRSVTCVEEDMQGNITPTEE
WKCLYSPKTAILQPCNSFSCPTWVAQEWSPCTVTCGQGLRYRVVLCIDHRGIHAGGCNPT
TKPHIKEECLVAVPCYKSIDTLPIEAKPVWQKQAIELEEEVTASEEPTFVPGPWQPCSRT
CGAGTQQRTVKCQVLLSFSQTVAELPDDECEGEKPDSVQPCYRKPCSGELGHRDENGEEE
EPRRGGDLLDWEYEGFTECSESCGGVLKQSVASLQNKQVKRQTHEETLSPSRDRDLFCCC
CDPCTPAWEAGQWSSCSTTCGVGLMTRTVTCTHRPSPNSNYSAVLKDDMCQKPKPSPFQA
CNRFDCPPTWDARDWGQCSQTCGGGVQKRQVFCKQRLADGSILELPDTFCPSRAPDNQRP
CGRQDCPPQWVTADWSQCSVTCGNGIQTLQAVCRKQGENGQYSIVNSINCSMIARPIRIR
SCFLRHCEDSPKPDATILGQRKVYIQWKKSKKLQLVVGGYAYLMPWTTLILRCPTRNIRK
GHIQWLKEGKPLVNRPQFSIKSQGFLKIQQVHPTDAGIYTCTAGSAREHFVLHILGSKKK
LAVTESWLNKSGQHKTTRPGITSTRGTMQELPIPLNKYDSLVERMLELKGYYHNKKYLAD
KPYSSEKNKLTLENDGTNADSPIPAMLVSDSIKLDELMRNLSEGFGRQQGEHFIMQFLSE
IATTQGDADESTVHPPDGAESSTNGPTLYKPNLKTHISRAGSPEFIQQPKKTTVSPQSEV
VFHIGTPVFLRKPVASLELRCHPVGNPQPSLMWTKNGNQLHFDSRVGLSASGSLRIQSPG
KEDEGLYTCTARNRHGSTTLSSWLRITSKVLFWILICTHLTTSTITVKICICTICVGLKL
TRTFGNLQKPNLNKTLERFLSNTIKLNRTFVLEDIGLKVVKNGSTLFSLYFTSDSIKGSV
IGVFQELFIEDSVDIPYNIPGSVCCFQVVKKEAVSVVTTPTNLVLRGQTAASQAAFAEDK
AAPSVNLIYLNFVKCFTLQFNLISLDQILFVWHISAARHFKCFTSLQTRFITESVQHKYH
KAPQTLLYIEIQSQLYTVQLCQNDTAMIKYYVYSSFLFFEHINIYLGQILARWRVDTWAP
CSASCGGGSQTRRVRCMMGPEGSLREVQTRHCLGKGKKPSSSRFCNILPCARWITSSWGL
CHGRCVGPSLATQHRDVHCKDTNGTKVSYRTCQGFRRPSSVRNCSTDACFLYWSVGPWTQ
CTASCGRHGFQSRQVTCKHRRTGRTTRDHHCMWRPRPSSWQRCNMLSCGREECRDSTRYC
ERVRQLELCPLQQFKSRCCHSCRKT
Download sequence
Identical sequences A0A087X369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]