SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087X387 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087X387
Domain Number 1 Region: 261-545
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.18e-46
Family Enolase 0.00027
Further Details:      
 
Domain Number 2 Region: 67-156,214-255
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.71e-18
Family Enolase N-terminal domain-like 0.0044
Further Details:      
 
Weak hits

Sequence:  A0A087X387
Domain Number - Region: 29-62
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00458
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087X387
Sequence length 568
Comment (tr|A0A087X387|A0A087X387_POEFO) Enolase family member 4 {ECO:0000313|Ensembl:ENSPFOP00000000240} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
STSALSSPRLEEMDIHKMRIAAAEFYRRNGVPAIIERALNELFLRQPADVHGYLANFFLE
LSTPPRISDLRGREVFSENGQLIVEVEVFSIVCNKEKSMSSAAVVSHFAPVGTEESQRNS
DHVETALQWIHELFRKLLLNQNPCDQAEIDQMLSDFFRSYHEEEKARRDKLKAEASELEA
AARTTPVMPSKEKKSAGKVSGKKSVVVEKQFPPPEPPEPLLLEGMAVGSVSLAVAKSGAK
IKGMPLYKYISALKNQKDPTHFHVPVPWITLLSCGKKSPGKLCLLEEIILISKVGHPVKQ
SVTLACELQKEMMRLMSMSGKGGITLSSVSHNGVLTASCERPDQPLDLITNACTNLKVPL
GVHVFLALNCAAPKLVDYSKGKYEVATGGLKSPDELIEVYNNLISKYPAVVAVIDPFRRE
EAEQWKKLSDRIGISCSLLSDITHKAQAPALPGVHGYVFRHANETTVSDIIHATFCYQGT
RCSVVMDTMLSESSSDGSFADLAVGLGLDYVKLGGLGGAETMAKYNRLISIEEELAQQGL
LEWKNENLLRLISHLCNVPLPHETPDEP
Download sequence
Identical sequences A0A087X387
ENSPFOP00000000240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]