SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087X399 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087X399
Domain Number 1 Region: 110-194
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000000171
Family Snake venom toxins 0.074
Further Details:      
 
Domain Number 2 Region: 17-97
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000002
Family Extracellular domain of cell surface receptors 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087X399
Sequence length 215
Comment (tr|A0A087X399|A0A087X399_POEFO) Uncharacterized protein {ECO:0000313|Ensembl:ENSPFOP00000000252} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MFLFALVLGVLFLPEADTLKCKCSPSIYGSCSGESECPSQNDHCLTATQTTIHGDKVSEH
NVKSCMKAELCLDFSINNGFHRLLQKSSCCNGDLCNTQTDYPKPDNKSTPNGKKCFACDG
ENCMKTLNCLGDENYCVKVTGNVQGVSLTTKGCASKAVCSDQISSVVNQVTSRILGQVIG
VKLSCCQGDYCNSASSASPVLLLLLVPLLFSNLFS
Download sequence
Identical sequences A0A087X399
XP_007543328.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]