SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087X468 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087X468
Domain Number 1 Region: 271-328
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000229
Family BSTI 0.044
Further Details:      
 
Domain Number 2 Region: 632-694
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000327
Family ATI-like 0.027
Further Details:      
 
Domain Number 3 Region: 796-836
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000126
Family Fibronectin type I module 0.087
Further Details:      
 
Domain Number 4 Region: 731-798
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000051
Family ATI-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087X468
Sequence length 1455
Comment (tr|A0A087X468|A0A087X468_POEFO) Uncharacterized protein {ECO:0000313|Ensembl:ENSPFOP00000000571} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
NHVNNICSTWGTQHFKTFDGDVFQFPGLCEYNLVKDCRESENKFSVHIRREENDGNITIS
YVVVTISENTFTLTKTEVAENENPVTLPHYSGGVKVEESTFYIKLRATKVGIIVMWNRED
AVMVEVSNTYQNQTCGLCGDYNGVPVYDEFMDNGFKMTPIEFGIKHRVHLPNDGCKDPHV
EDDESKTNVSDSCKAFQTICEQIFHGDSWSSCAGLISAEAFIQACVVDMCACNNGTSDLC
VCSTMSEFSRQCSHAGGQPPNWRRPDFCGKQCPYNMRFEESAFPCMDTCTHQDTRLVCED
HKTDGCFCPPGTVFDDISERGCIPRSECQCKHDRIYDSGEVYRHEKTNCTCSEGKWECET
FERPATCSVEEGSHFTTFDGTTYAFHGNCIYTLAKDGVSPNFTIRAHLDQCAQKRADICL
KALKIHLGTDNVLMFTSEGKVQQNMEDISLPYYSGDIRIFHASSFHILLNAKFGLQIQIQ
RVPVMQVYISLESSYKEKTSGLCGNYNMALNDDMKTPQGCQEGTALTFGNSWKADQTCPD
ASKELDSPCSISMETENYARHWCEMLRNPNGTFANCHSEVNPEYYYKRCLYSTCSCEKSE
DCLCAVFTSYGRACAAKGKFVTDFGDQCEKHTKSCPSSQIFTYNHRRCQLTCSSLSSDQR
SCTSNFLPVVGCFCPDGLYLNEKDTCVPKEECSCFHKGEYIEAGKSLNIDTEHCVCDDGK
LHCHPRKNESFACPASKVYFNCSSTSAKTLGPQCARSCMNLIDNICDASECVSGCMCPPD
QLDDGKGSCVKNESECPCQHNGKFYKPEGTFHQDCNLCTCRGGKWICTMNNCSQSCIIYG
SGHHRTFDMRQYEFQGHCSYVAIKNNCFNKTAESDIEVITEDEPCGSTGTTCSKTVRIQL
GRNVITLSDGTYKKEVLENGTQIKYQIINRGFYIVLASDIGLTVIWDRKTYFVIQLESQF
MGEVCGLCGNFDGNGENDFTTRSGLVVSSPLEFANSWKGDSSCSDVDKLVDACEEAHHRD
HWAKMKCNIINGDTFKDCHSKVEPTPFYENCVKDTCACDTGGDCECFCSAVAAYAQACNE
ADVLISWRTPEICPVFCDYYNNHGDCLWHYRSGTPDAYLTCSNYFLHVPNLEGCYPHCPE
YAQAFDEESKQCVQCRQYETTTTPTPTTTTNTATTTESTTEFTTKTETPTTTSTITTTTP
TTSTESTTVTYPTTTTTPPTESTTPRHSTTTTETPTTTPTTTTTTTSTESTTKPTGTTES
TTPSTKSTTVTYPTTTTTPTTESTTPRHSTTTTEIPTTTPTTTITTTSTESTTKPTGTTE
STTPSTKSTTVTYPTTTTTPPTESTTPTQSTTTTETPTTTPTTTTTTTSTESTTKPTGTT
ESTTPSTKSTTVTYPTTTTTPPTESTTPTQSTTTTETPTTTPTITTTTTSTESTTKPTGT
TESTTPSTKSTTVTY
Download sequence
Identical sequences A0A087X468
ENSPFOP00000000571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]