SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087XFI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XFI3
Domain Number 1 Region: 1017-1103
Classification Level Classification E-value
Superfamily Immunoglobulin 7.48e-22
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 660-716
Classification Level Classification E-value
Superfamily BPTI-like 5.25e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0023
Further Details:      
 
Domain Number 3 Region: 929-1014
Classification Level Classification E-value
Superfamily Immunoglobulin 4.56e-16
Family I set domains 0.029
Further Details:      
 
Domain Number 4 Region: 821-910
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000281
Family I set domains 0.035
Further Details:      
 
Domain Number 5 Region: 257-313
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000105
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 6 Region: 317-376
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000105
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 7 Region: 376-432
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 
Domain Number 8 Region: 436-491
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000497
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087XFI3
Sequence length 1161
Comment (tr|A0A087XFI3|A0A087XFI3_POEFO) Papilin a, proteoglycan-like sulfated glycoprotein {ECO:0000313|Ensembl:ENSPFOP00000004536} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MRTRRCITQRTDGGHNCVGPDKSYRICNIQDCPEGSRDFREEQCSQFDGTDFQGKRYKWL
PYYGAANPCELNCMPRGENFYYRHRSSVADGTPCHPGRRDICVGGVCKRLGCDNMLESSQ
QEDPCLQCGGRGQSCHLVKNTFTTRDLPAGYNQMFIIPVGATTISIRETTASRNYLAIKN
LRGEYYLNGHWVIEFSRATPIAGTMLYYQRGAEGENVPETVIGRGPTTEPLVVELISQEP
NPGIEYEYYLPNGRSRQGYYWSFGSWSSCSKECGSGYQSRLVFCSIDNEAYPDYLCASLP
RPQSNRTCNPHPCPQTQSWRTGEWNACSVTCGGGSQLRSVQCILHDASGPQVVEDAVCAT
YADAPLSLRTCNMHKCAEYRVTRWSSCSVSCGSGEQTREVTCVGSGGTMLEEASCRTLLR
PPSVQPCEMPACPRQIHWHVGAWGLCSRSCGSGSRERQVICSDQERNLYHVDQCNAHPKP
STMERCNTQPCFSPQVVPSIQNPRGHDSAQTGFQPYMPDLSTARRPETRDPTQRNTVQDP
HDFSPALHCSQSNYGCCPDGRTSARGPQGLGCPQTPAATPGPSSCDQTSYGCCQDGVRAA
QGPNREGCLEYVAPAPTVASLPTENAVECRMTTYGCCYDRKTPAGGPNGEGCPNPPNHIE
RSICSLPRAAGSCSSWVARYHFDVVTSKCAHFWYGGCHGNSNNFMSRAECQQACQGPASS
QQRPQPVLPVGRSTPTRESALERTAPRGSPDAQSPDMGRTFTAQGGLPSDSGRHGTSAAR
HAHKARVYLRTRRPLTGARAQMTGPAASLTLAGVSIDKSDPDKVEALVGQTVVLPCRVIP
PPSSTVVVEWRRDGIPLSAQRHHQQPNGSLLVGPLMTSDSGWFLCFVTRERERDHRYIYL
SVSDAPSQPFPTLLPKDGPIPRFSIDQSSPSTTEMRTGQSVRLPCTIVPAAALQSVTIQW
TKDGKTLSDSRITQHAEGTLEISPLRPDDSGVYTCTAASQQQLEQRQLQLRVQADLKITT
APNNIQVTEGSTAVLPCVVSGDNVNIGWSRNGVPVRPDGHNILVSSDGSLMINNVKTSDE
GTYTCNAYTGIYSVSATAEVRVIKDSQGADVPPGCVDQPELANCKLIVYARLCDHQYYSS
FCCASCARHAPKNGRTGRHVF
Download sequence
Identical sequences A0A087XFI3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]