SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087XFY3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XFY3
Domain Number 1 Region: 20-33,60-166
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000107
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087XFY3
Sequence length 861
Comment (tr|A0A087XFY3|A0A087XFY3_POEFO) Transient receptor potential cation channel, subfamily C, member 2b {ECO:0000313|Ensembl:ENSPFOP00000004686} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MENLTPEQWREIMNKKMRFPPELLNAIQEGKIELLCGLLRTGDGIIRQLDESEDRQWREA
LNLSIRLGNEDAMDALLQGVKFDFRQIHEALLVAVDTNQPKVVKRLLDRLDQEKGNKMDV
RSFSQAIFDRSIDNSQFAPGVTPLTLACQKDLYEIVTMLTQKGHGIPWPHKISCACLECR
NGRQYDLLKFSLSRINTYRGIASRAYLSVTSSDAMLSAFSLSRELRKLSQKEPEFKPQYL
GLEQLCQEFAVELLGMCRNQSEVTTILNSCGDESQDALDEEAFEEGIPNLSRLRLAVNYS
QKQFVAHPICQQVLSSIWCGNLAGWRGSRTVWKLLVSVGIFLTMPFLCLVYWIAPKSKAG
KMIRIPVIKFLLHSASYLWFLITLLGESITMEMYRDKFASRQQNILHSSFHMVWVVGFFW
YECKEVWIEGLRSYFLDWWNCLDMMVLSMYLASFALRVLIMLKGHFLCHDQSNSDECIYF
TQTVRDDWRQEDPQLISEVLFAVTSMLSFTRLAYILPAHESLGTLQISIGKMIDDMMRFM
FILMIIGTAFLCGINNVYVPYVISPHLGRFNETFNFLFWTMFGVANQDYVDMPQFVLAEF
VGRILYGIFTLVIVIVLLNMLIAMITNSFQKIEDDADVEWKFARSKLYLSYFREGLTMPV
PFNIIPSPKAVFYVLRGIFKRLCCCCNFNSEQKYPPIASMKKSNDKGTEDNLPYRQQVIR
ALVQRYIESARREFEETKRKDIGNRITELNKAVSRMHLEMKGIQQLLMTDGHAANDALTK
DGSSVLGKYIIGAKNNFRGFNTRQDDKSTSLKVTVHQKEEGADERKADSEARQDTDAQLD
QVDENEEELDKAADCEVVKME
Download sequence
Identical sequences A0A087XFY3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]