SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087XJ20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XJ20
Domain Number 1 Region: 387-443
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000249
Family TSP-1 type 1 repeat 0.00036
Further Details:      
 
Domain Number 2 Region: 500-549
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000589
Family TSP-1 type 1 repeat 0.00053
Further Details:      
 
Domain Number 3 Region: 442-498
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000785
Family TSP-1 type 1 repeat 0.00041
Further Details:      
 
Domain Number 4 Region: 243-296
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000288
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 5 Region: 341-384
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000131
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087XJ20
Sequence length 1593
Comment (tr|A0A087XJ20|A0A087XJ20_POEFO) Adhesion G protein-coupled receptor B1a {ECO:0000313|Ensembl:ENSPFOP00000005773} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MKNLCLIAGHSGWPFPALLSFCATFLLMGGCYHAAPSGPESDSCSTLVQNRFFGFFLSSS
VFPTVPCSWTLQNPDPRRYTTFIKVTKPTGGCQPFQLRTFQYDSFLETTRTYLGMESFDE
IVRLCDSSVPVAFLEAGKQFLQMRKGPPRAGMAIQNGDEDFKTEYLVVGKRNPSMAACQM
LCQWLEDCLASSTSNRPCGIMQTPCLCWDKPPQLSLGDSCYHNGVYLENCLPSVKESGKD
VEINGGWSVWGHWGQCSSECGGGIQTRARTCQSPPEESFLCEGIVEEGRPCNSQSCTGKG
RHLSRSQSLRSVDNPKRDDTDKPPRSGQQSPQEVESTSGEEWSSWSVCSATCGEGWQSRT
RFCVSSSYSTHCSGPLREQRPCNTSAICPVHGTWDEWSPWSLCSSTCGRGYRARTRTCSP
PQFEGKPCDGPEKQTKFCNIAVCPVDGVWNEWSSWSSCSTTCSNGTMQRTRECNGPSYGG
SECRGEWLETVDCFLRDCPVDGKWQPWSLWSGCSKTCGGGMQQRNRVCYGPFFEGQDCPG
ERQQIRHCNEKRCPAPHEICDEDNFSKVVWKMTPAGDTAAVQCDSNAIGVILRRCSLDEE
GIAYWENPTYMKCISNDYRNIQTLTREHLSKAQRGLVGDGVSEVMNKLRMTSDDGTSYSG
DLLAILDVLKNMTEIFRRAYYSPTSADMRNFVQTVSNLLMEENRDRWEEAQLLGSNIKEL
FRLMEDFVDVIGLRMKEFRDMYEVTDNLVLSIHKRPVMDQADFNFPMKGWRGMVDWARNS
EDRVSIPKNILSTGKPEADDDSTFVTGVVLYRNLGSILSLQRNNTILNSKLLSVTIKPLP
ASLSTPVVVEFSHLHNGTTNQTCISWDESDSSSLLGSWSARGCRAVLVDSFRTKCVCDRL
STFAILARLNPDMNMDKMQLPSVTLIVGCGVSSLTLLLLIIIYVSVWKYIRSERSVILIN
FCLSIISSNALILIGQTQTRNKVLCTLIAAFLHFFFLSSFCWVLTEAWQSYMAVTGRLRN
RIIRKRFLCLGWGLPALVVAISVGFTKAKGYGTPNYCWLSLEGGLLYAFVGPAAAVVLVN
MVIGILVFNKLVSKDGITDMKLKERAGQMTVPLYNMTLKCAKCGVISSADVSTTATSNAM
ASLWSSCVVLPLLALTWMSAVLAITDRRSALFQILFAVFDSLEGFVIVMVHCILRREVQE
AVKCRVVDRQEDTNGDSGGSFQNGHAQLMTDFEKDVDMACRSSTAKRSSLQGEDKASAGT
LTLQKGSNFNTMPASMTKVHLQNVADYSSHTLSLRREKGAAAKGISTELPGAKSIYICDG
ELFKQLDGELPRGNGEGSSSDSTGKGPGYIILPANNTGTQKAAKGKDDQTSKYNITMEQL
PQSRLIHLANSTAGEPVPGFGLKSLPTDQVSVSCTDRDSPAHNLHNMPRDSQTTSSLADA
GDSGNSGVMSKSETVSTLSMSSLERRKSRYAELDFEKIMHTRKRHQDMFQDLNRKIQSAD
KDRESPPVDAKAAKRWSVSSTGSDKTNMSDKQQTPSKRVWEGIRKPHSPPSWVRKELEAV
AASPLELQTVEWEKSSATIPLVGQEIMDLQTEV
Download sequence
Identical sequences A0A087XJ20
XP_007550473.2.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]