SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087XJE2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XJE2
Domain Number 1 Region: 35-176
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-40
Family Regulator of G-protein signaling, RGS 0.0000935
Further Details:      
 
Domain Number 2 Region: 350-440
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.96e-25
Family Ras-binding domain, RBD 0.005
Further Details:      
 
Domain Number 3 Region: 296-364
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.72e-17
Family Ras-binding domain, RBD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087XJE2
Sequence length 586
Comment (tr|A0A087XJE2|A0A087XJE2_POEFO) Regulator of G protein signaling 14a {ECO:0000313|Ensembl:ENSPFOP00000005895} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MAKNCNSLGIPLAHMSQAVSDGELNMTARGCGGSSSSLPGTPGGDVNSANSVLSWAVSFE
KLLEDPHGVSYFTAFLKSEVSAENILFWQECEKFRKIPATSLDRLKAAARSIYDTYLSDC
APYSVNIDDTAKTEEKDLEQPTPDMFSKAQAQIFKLMKMDSYRRFVRSPLYQRCTLASVE
GKFLPQLSTEPVRMGSWDDMANKSPSSDKKNRKSDSNSLPSGKSVSEKQRQKRGSWGDAS
NGQGSGPLKQSNMSIKSTSSVELGSLCRQMENGWPGPTSRDQAAGIVSRMGMEGGYCCVY
LPDGSASLAPTRNGQPIKDMLASLCEKRGFPLKDVMIYLHGKDKPLSLDQDCSVLRDQQV
SLELRVTFALENAFTGKTVGIMAKSSKTLQDALCSVMQKHNLKPQETVVTMVGSDVPVNL
NCSVYKLANKTLRLEKAKGKDQAIISRGGSSPNAQPGAGSGGLEPQLSTQTDRVRTQHRP
SKNRDMDGFLDMLTRAQCCRVDDQRGLLTKEQLEIPSFLQLSSDQGQNTDDSSATSSSTT
DSKPESGDNSDAPDPAPVPDPAPANKSEESSAAPKSESKDLRETTV
Download sequence
Identical sequences A0A087XJE2
XP_007548374.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]