SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087XKH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A087XKH9
Domain Number - Region: 23-72
Classification Level Classification E-value
Superfamily XPC-binding domain 0.00824
Family XPC-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087XKH9
Sequence length 81
Comment (tr|A0A087XKH9|A0A087XKH9_POEFO) Uncharacterized protein {ECO:0000313|Ensembl:ENSPFOP00000006282} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MSGMRTILTSTAAIAFMGFGYGMWSVISPGEQRREEMLKNLPESNPVRMEETRQRNAMLM
QVLRDAAETSDNLARGLGPGK
Download sequence
Identical sequences A0A087XKH9
XP_007577505.1.10163 ENSPFOP00000006282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]