SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087XMI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XMI3
Domain Number 1 Region: 252-463
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.29e-59
Family Reprolysin-like 0.00052
Further Details:      
 
Domain Number 2 Region: 550-607
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000759
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 3 Region: 1202-1261
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000262
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 1347-1406
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000196
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 5 Region: 957-1018
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000968
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 1297-1350
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 7 Region: 1153-1203
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000034
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 
Domain Number 8 Region: 1072-1132
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000051
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number 9 Region: 1017-1075
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000523
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 10 Region: 1461-1521
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000432
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 11 Region: 1411-1465
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000116
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 12 Region: 1579-1614
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000123
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 
Domain Number 13 Region: 1649-1702
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 14 Region: 1517-1579
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000837
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087XMI3
Sequence length 1904
Comment (tr|A0A087XMI3|A0A087XMI3_POEFO) ADAM metallopeptidase with thrombospondin type 1 motif 20 {ECO:0000313|Ensembl:ENSPFOP00000006986} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN=ADAMTS20 OC=Poeciliinae; Poecilia.
Sequence
MHLAIWLVGLTCHLSALARETLQYRLHPKQESFIKQLSSYEIITPLRVNDFGESFPHKLH
YRRRRRSLSDDLSGLRLLYRIDAFGERFHLDLSADSSFIAPSYTVTHLGAERSSGDADSH
FHDPGDMRHCFFRGHVNAKSEHPAVFSLCTGLVGTFATQHAEYFLEPLLNVSGAEYDEEH
KKPHLVYRHERRRNASHPDEPCAASVNFQESTSMEESPDGSLEGDENLAELSVFQIDGHN
LSLYSRRKRFLSYPRYVELMVTADAKMARHHGRNLEHYILTIMSVVAAVYRDPSVGNLIN
IMIVKLVIIHNEQEGPTVSFNAATTLHNFCVWQQSQNIQDDSHPSHHDTALLITREDICR
AKDKCDTLGLAELGTMCDPFRSCSISEENGISASFTIAHELGHVFNMPHDDNPKCREAGM
KHQYHVMAPTLNYDTNPWSWSKCSRKYITEFLDTGYGECLLDEPVGRTYELPTLLPGQIY
NANKQCELMFGPGSQICPYMKQCKRLWCTSAEGDHKGCRTQHMPLADGTECGHGMYCKHG
MCINKELDIRPVNGEWGPWGPYSVCSRSCGGGTRSTTRDCNKPEPRNGGRFCVGRRMKFR
SCNTEPCPRERKDFREEQCSQFDGKHFNINGLPPSVRWVPKYSGILMKDRCKLFCRVAGT
MAYYQLKDRVVDGTPCGPDTYDICVQGLCRQAGCDHVLNSKARNDKCGVCGGDNSSCKTL
AGTFNDAQYGYNTVVRIPAGATNIDVKQVSYSGKPEDDNYLALSDGQSNFLLNGNFVVAM
FKREITFKGTVIEYSGSDTKVERINCTDRIEEELVLQVLCVGNLYNPDVRYSFNIPIEEQ
GEQFVWDPSGSWLECSRLCQGERRRKAVCVRDSDHLEVSDQRCEHLPRPVAFTEPCNTDC
EVRWHVAGKSDCSAKCGPGYRSLDVQCMKYSRTKRRSERMEASVCGDIAKPQMRETCHGD
CLLKSWQYSAWSQCSKTCGRGIRSRESYCMNNLGRRLVDRECSDYERAVTEPCNDQPCPK
WTVSEWSECLVTCGKGMRHRQVSCTTGAGEEKLSEHFCDPSSKPPTVGSCKLPECATWQV
GVWGACAVTCGHGYQMRAVRCVLGDYGDSVDDRECNAAARPRDSQDCEMPACPQTSAAQV
TPRPDNTVQLVTQWRFGSWTSCSVSCGKGKRARYVSCRDAQGGVADESYCAHLPRPPEFS
TCFSPCGQWHAGEWSACSVTCGVGRTTRHVVCSDYHQPVDQSLCDPDERPAAEEECTAAP
CPSAYNRQHIYEQPYGYPQDPGRHPGHSSWNVPSADNQWRTGPWGACSSTCAGGFQRRVV
VCQDADGRSNSYCDERVKPAESKSCDSGPCPLWNYGVWGECTQTCGGGRKTRLVVCQRPS
GQRLNDYNCDVLDKPHDVEQCNLQSCPGAASWHRRPWKPCSVSCGRGTKQREIACVFQNQ
TQIKDAYCGHLPRPRAQKACRARGCPAWKANRWRQCSVTCGSGVQQRDVYCRLKGSGRVR
EDLCSPHLRPPTVQVCQTAECTRYTWVASEWEQCNATCGEGMKSRKVRCVGPGLTPAHDD
RCGPSTRPPSLHHCREEPCLYTWTTGEWSQCSASCGVGYQQRFVSCSLMPSSSHSQRFHA
QPSSAGKICPQPHPPATQPCLLTECPHSSYWKVGPWTECSLTCGAGVMERRVECVTSKGQ
MSKHCRPSDRPESQAACQERQCQAFTSCRDIQLNQGVRMDGEYYLKVKFRTLQIYCAEMQ
TDFPKEYVTLRSGQTDNYSEVYGHRLISPFECPYNGSRTQDCDCRNDYLAAGYTLFHKVR
LDLNSLRIMITDLRFSQTIHGRPVPFATAGDCYSAAKCPQGQFSINLIGTGLKVAANTKW
TSQGNYVSVKVHRSEDGTRIYGRCGGFCGKCIPHAHHGLLLQVH
Download sequence
Identical sequences A0A087XMI3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]