SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087XML8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XML8
Domain Number 1 Region: 69-199
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.1e-45
Family Regulator of G-protein signaling, RGS 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087XML8
Sequence length 205
Comment (tr|A0A087XML8|A0A087XML8_POEFO) Regulator of G protein signaling 13 {ECO:0000313|Ensembl:ENSPFOP00000007021} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MQLENSESSLPKETAHVQSAVAMPSLATLTPPQHLNMDIDKKAIGYSSGGNLKSRLQCKL
SQPSNTEELCFEEMSQWSQSLERLLSSKYGMKIFQAFLKSEFSDENLEFWVVCEDYKKIK
SSFRMSSRAKKIFKLYIQAEAPREINIDHKTREVIRTNMKVASAVCFEEAQKIVFGLMEK
DSYPRFLKSDIYRTLLDSTSAPMRM
Download sequence
Identical sequences A0A087XML8
XP_007554945.1.10163 XP_014844318.1.96476 XP_014886123.1.100837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]