SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087XMR6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XMR6
Domain Number 1 Region: 73-211
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.01e-37
Family Regulator of G-protein signaling, RGS 0.00000463
Further Details:      
 
Domain Number 2 Region: 757-837
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.23e-27
Family DIX domain 0.0000946
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087XMR6
Sequence length 838
Comment (tr|A0A087XMR6|A0A087XMR6_POEFO) Axin 2 (conductin, axil) {ECO:0000313|Ensembl:ENSPFOP00000007069} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MSRPLMDHIASSSFREDAPRPPVPGEEGDAPRYPSKAAVMKPLEAPKSALLAGSPGSSAR
RNEDGLGEPEGSASPDSPLSRWTKSLHSLLGDQDGAVLFRTFLEREKSADALDFWFACNG
FRQMDLKDTKTQRVAKAIYKRYIENNSVVAKQLKPPTKTFIRDNIKRQHIDSAMFDQAQT
EIQTDMEENAYQMFLTSDIYLEYVRTGGENPSHVSPGSLGSLKVVCGYLPTLNEEEEWSC
DFRAKALLALKGQRLPITQRAVEMMEKGYRSYKRGEQINPCHAGAFAPVSSTNDSEVSSD
ALTDDAMSVTDSSVDGIPPYKLGSKKQLQREMQRNMRMNSQVSLPAFPRTTRPPKEMVPL
EPAQFAAQLISRLENLKRKQDTFNSLEERLQQIQEEEEREDSEISVSAPQLSPHPLALLS
GSSDEDPQAILDEHLSRVLKTPGCQSPTVVQRSPRSSSPENRTYACGGKPRAGSSASPVS
SPDSGAFALSLGSSRTLLSRQSTKHIHHHYIHHHASPKSKEQIEREAALRVQGVCSAAGR
CQSCQAYPRSRSLGREMCGSVSTESNMGRSSSLSRRVCRSGAEEGVADGCMDDCGISQLP
TDTTDPTENVRQWILESKRQSRHKSHSNQGAKKFGGSSTQTHTWGGGGSCGHLRSHQPAQ
PFIQDPAMPPLPPPNTLSQLEEACRRLEEVSTKIPKQRHSLVSLQREKTHQVTVHAVGSA
LPSPAPLGPPGLTSTCPGLLQSEECKKVLGGQAACSGETVVTYFFCGEEIPYRRTMKSHS
LTLGHFKEQLRKKGNYRYYFKKASDEFECGAVFEEVSDDGSLLPTYEGKILGKVERMD
Download sequence
Identical sequences A0A087XMR6
XP_007557408.1.10163 XP_016529503.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]