SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087XQH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XQH4
Domain Number 1 Region: 6-68
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0000000000497
Family SNARE fusion complex 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087XQH4
Sequence length 99
Comment (tr|A0A087XQH4|A0A087XQH4_POEFO) Uncharacterized protein {ECO:0000313|Ensembl:ENSPFOP00000008027} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
VLQEEGKSRLHQTQEEVEQVKMIMLDNKKKAEERSDNLKDLELQAEVLREKSKVFERTTK
KLKQQKEMSNKKTKIIIIFSVVAGLIILGLIIFITKFAG
Download sequence
Identical sequences A0A087XQH4
ENSPFOP00000008027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]