SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087XRA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XRA3
Domain Number 1 Region: 107-208
Classification Level Classification E-value
Superfamily Immunoglobulin 2.05e-18
Family I set domains 0.023
Further Details:      
 
Domain Number 2 Region: 2-78
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000753
Family Growth factor receptor domain 0.0021
Further Details:      
 
Domain Number 3 Region: 65-105
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000032
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087XRA3
Sequence length 243
Comment (tr|A0A087XRA3|A0A087XRA3_POEFO) Kazal-type serine peptidase inhibitor domain 3 {ECO:0000313|Ensembl:ENSPFOP00000008306} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
GRCGPCDPELCPEPRGCRAGLVPDRCGCCSECGNLEGQVCDPGARARFYGLCGTGLRCQA
DRAVCVCEQQGALCGSDGTTYLNLCRFREAAFSDPELRTAGRGPCRTAPVIKVAPQDQVN
GSGSIMLFLCEVFAFPMALVEWRKDGRDVVLPGDDPHISVQARGGPLRFELSSWLQIEGA
EPADSGTYRCIARNELGSVSASAVLGVLGAGETHLGGAEVRGHHGQTNQEDGKVRESGSA
PSD
Download sequence
Identical sequences A0A087XRA3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]