SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087XRG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XRG7
Domain Number 1 Region: 190-530
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.88e-80
Family Protein kinases, catalytic subunit 0.00000098
Further Details:      
 
Domain Number 2 Region: 36-184
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.35e-33
Family Regulator of G-protein signaling, RGS 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087XRG7
Sequence length 559
Comment (tr|A0A087XRG7|A0A087XRG7_POEFO) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MDIGGLETVVANSAYVSARGGADGCAAAAMRDKKMRARLKLPHIRDCQHMKTTVDTTFES
MCTKQPIGKRLFQQFLQSSATYKDAGDLWKDIEDYGISQENDRLQKARRMVNTYYETASK
HFCSFLEEKAVIRVKEDLKNVRADLFKESEQQLLQHLEKKALDEFKSSKFFLRFVQFKWL
ESQPFDEEWFMDFRVLGKGGFGEVFACQAKATGKMYANKKLEKKRLKKRKGYEGAMVEKR
ILAKVHSRFIVTLAYAFQTKIDLCLVMTIMNGGDLRFHMYNVDENNPGFDEKRARFYTAQ
IICGLEHLHQHRIIYRDLKPENVLLDDAGHVRLSDLGLAVELPPGKDKTTGFAGTPGFMA
PELLQKVDYDYTVDYFTLGVTVYEMIAAKGPFRVRGEKVENDEVARRTLNDPVSYPPSFS
KESKDLCEGLMEKDPAKRLGFKDNGCTELKNQPFFKEINWGRLEAGMLLPPFVPDPKMVY
AKDIDEVGVFSTIKGVALDDKDAEFYSDFASGNIPIPWQEEMIETGVFGEMNVWGEGGKL
PNNLDPNYVEAKGGACVLL
Download sequence
Identical sequences A0A087XRG7
XP_007563233.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]