SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087XT73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XT73
Domain Number 1 Region: 576-640
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000792
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 503-549
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000012
Family TSP-1 type 1 repeat 0.00056
Further Details:      
 
Domain Number 3 Region: 39-86
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000222
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 4 Region: 631-688
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000129
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 5 Region: 92-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000302
Family LDL receptor-like module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087XT73
Sequence length 851
Comment (tr|A0A087XT73|A0A087XT73_POEFO) Complement component 7a {ECO:0000313|Ensembl:ENSPFOP00000008976} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MSPVCSASNTMKNIVQLCATVSLLFLTLHLARVFCVQRVHCQWGPFGSWSACDPCTKLQT
RSRAMAVYAQFDGNPCDGGHTETRPCETTQACPLDDGCGDRFRCRSGKCISKSLLCNGDQ
DCEEDGLDERDCPVQKFITCEHTVPPPQVELLGNGFDVVSGKSRGSVINTKSFGGQCRSV
FSDVHKTIYRLPLSAIQYNFLVTVQKDFSDETFTSQWHYAKDIVNRQTVAGTTSGHRNYD
FHDKHDTSQTRRIVVLKNEIEVAQFQSNSPKYLPISEEFWKALAKLPSVYDYSAYRKILE
RFGTHYISEGSMGGSLNSIVSINEETENRIKSESFDNHECERKKRWILFFPITRVVCTTS
TGSRTWHSDTSTSDNNAKVEVQGGGPSHIAALEKMQLDDADKNWELYSNWADSITSLPVV
IKQKLRPLSELVKEVQCSGLKRLFLRKAIEQYLYESHPCHCQSCRNNGLAVMDGDKCKCI
CKTGTSGLACEQGVEAEGQPGVIHGSWSCWSAWSLCSGGRSSRSRSCSNPSPQNGGHHCI
GESTETAGCEEQEDLEYLKTMEPQCFDQTLPELQKCVTPPNLINGYILDPKDNYYVGNRV
EYSCTAGFYLVGISILQCNADQTWSANPGLCAVSVCKLPPLAEDVVASPSQEAYHLGDSV
SFSCPHGRSLDGEATAICDSSLNFSPDPAQTRCIQAERSQKPTASPAQCKQWQKSFRGKC
VCRMPPECSSSLELCAISPLDGQFVLLTVCKIQAIKCIGKNLEIADDSNCKWPQRSNTDC
TRCHMWENCDAQTNQCRCKDSADCLIPGESVCIRVGEDATVAPQTMSECEAGLRRCKGEK
VTVVSIQPCAS
Download sequence
Identical sequences A0A087XT73
ENSPFOP00000008976 XP_007557661.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]