SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087XUU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XUU5
Domain Number 1 Region: 44-108
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000298
Family Growth factor receptor domain 0.005
Further Details:      
 
Domain Number 2 Region: 107-178
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000324
Family VWC domain 0.038
Further Details:      
 
Domain Number 3 Region: 212-255
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000589
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087XUU5
Sequence length 367
Comment (tr|A0A087XUU5|A0A087XUU5_POEFO) Nephroblastoma overexpressed {ECO:0000313|Ensembl:ENSPFOP00000009548} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN=NOV OC=Poeciliinae; Poecilia.
Sequence
MDFFFTNIFNFVLHDKKMTNLSAVLVFFMTAQTFTVIGAQTCPRRCLCPAELPVCLPGVP
LVLDDCACCLVCAGQKGQACSEMKPCDTIKGLQCDYSVDVHKRTGICAVSVGNVCVLEGL
VYQHGQIFFPSCKYQCVCQNGQIACIPRCNLDVMLPGPDCPVPRKVQVPGECCEKWVCEP
QTEASALGGFAMAAFRQEETVGFGSWDPRLTCIEQTTEWGACSETCGMGVSTRVTNKNNH
CEMVKQSRLCMIRPCEDLQGQLTQVALMQRDRRCQRVVRSNKPVHLEHENCTSILAYKPR
YCGTCTDGRCCTPHKTKTTLVKFQCPDNRIRRRPVMAILTCVCHTHCPQDNVAWEPSLLL
YGGMTGR
Download sequence
Identical sequences A0A087XUU5
XP_007571123.1.10163 XP_014865627.1.96476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]