SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087XVD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XVD5
Domain Number 1 Region: 100-235
Classification Level Classification E-value
Superfamily Cap-Gly domain 4.32e-37
Family Cap-Gly domain 0.0000341
Further Details:      
 
Domain Number 2 Region: 8-96
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.96e-21
Family Ubiquitin-related 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087XVD5
Sequence length 246
Comment (tr|A0A087XVD5|A0A087XVD5_POEFO) Tubulin folding cofactor B {ECO:0000313|Ensembl:ENSPFOP00000009738} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MDGEVTVVTNPFVNVRITSSLSSFENRRRFNKRITIAELKMLLEMNVGVPASSMDLEIFS
TTDRFLQKIDNNEALFGSYPVDDECRIHVIDRSGGQTSELFDDSKVEKFELSDEAYEQRK
ESVRSFLKKQNLGRFNEEEATKKKAELTIREEQQKTAAEAISVGSRCKVEVPGQPTKLGT
VMYVGTTEFKSGHWVGVKYDEPLGKHNGTVQGKQYFECQDKYGAFVKPLNVTVGDFPEED
YGLDEI
Download sequence
Identical sequences A0A087XVD5
ENSPFOP00000009738 XP_007549530.1.10163 XP_014877046.1.100837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]