SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087XVP2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087XVP2
Domain Number 1 Region: 10-51
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000128
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087XVP2
Sequence length 210
Comment (tr|A0A087XVP2|A0A087XVP2_POEFO) Rhophilin associated tail protein 1-like {ECO:0000313|Ensembl:ENSPFOP00000009845} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MPLPDTFYCAQQINIPPELPDILKSFTKAAIRTQPKDLLQWCSAYFHALAKGECLPVKER
LEMNVATQKTDTGLTPGLLKILHKQLSPKETCSKEDVQLKWKALCLPMEQLEALLSLGSF
GSEINWMEFFALGCSALGGSLISSMKHACEILTTDEEGGPSRIPFDTFSHLYTYLAEIDG
EEPEDQTENFLHLLQQQVYKYNKMSSGPHH
Download sequence
Identical sequences A0A087XVP2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]