SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087Y3L0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087Y3L0
Domain Number 1 Region: 35-139
Classification Level Classification E-value
Superfamily Cystatin/monellin 5.32e-24
Family Cystatins 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087Y3L0
Sequence length 142
Comment (tr|A0A087Y3L0|A0A087Y3L0_POEFO) Cystatin {ECO:0000256|RuleBase:RU362130} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MSLPLSFLICLSVFHLCLGTGPVEELIKVKKVHLLGGWSERSLESKDVQRAAQYAVEMYN
KDSQDKELFKLVSVPSAKSQVTNMINFKIDAILGRTKCLKTQNLDIKSCDLDKEQVKCQF
FVTLNPHNDKHELNTKTCNKVT
Download sequence
Identical sequences A0A087Y3L0
ENSPFOP00000012613 XP_007561705.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]