SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087Y7N4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087Y7N4
Domain Number 1 Region: 154-287
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-44
Family Regulator of G-protein signaling, RGS 0.00000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087Y7N4
Sequence length 293
Comment (tr|A0A087Y7N4|A0A087Y7N4_POEFO) Regulator of G protein signaling 20 {ECO:0000313|Ensembl:ENSPFOP00000014037} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN=RGS20 OC=Poeciliinae; Poecilia.
Sequence
MKKSCRLSVCSRCFNRSCCGRACMHVVAEKSFSHLQGTHARRGNQLVCVKSEADGCDRAE
NHLYSGIHGDTSMGSERAEMRKRQMQVHQEAAASVLQARHKMGNTPTNASNACCFCWCCC
CSCSCLTVRGDEETIQRSTFEQQPEGNSNCEESPKPTVDEARSWAVSFEKLMKSAAGRSC
FRQFLRTEFSEENMMFWLACEDLKKETNKTVVEEKVRQIYEDFISILSPKEVSLDSRVRE
VINRNMLEPTSCTFDDAQQQIYTLMQRDSYPRYINSPAYTDLLNSLEEPPPEP
Download sequence
Identical sequences A0A087Y7N4
XP_007569181.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]