SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087Y8C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087Y8C6
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily DEATH domain 1.94e-23
Family Caspase recruitment domain, CARD 0.00029
Further Details:      
 
Domain Number 2 Region: 129-212
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000801
Family DEATH domain, DD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087Y8C6
Sequence length 219
Comment (tr|A0A087Y8C6|A0A087Y8C6_POEFO) CASP2 and RIPK1 domain containing adaptor with death domain {ECO:0000313|Ensembl:ENSPFOP00000014279} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MEPEHRAVLRKFRVQLSDQLLISDTIVPFLYQEGVLTEAQVEQVEGQLTNRQKNLKLLDL
LPNRGPRAFCAFLEALRDFGWIRDRLLLELQNSAGTGPPGPNLAENGLSGGAAVTARYHG
DGSRIPDSVLQRVPSDRELSRLAQRLGAEWEPVLLDLGLSAEAVYRCRSDHSLNTGAAVL
NGLVLWRRAGGRRATVGRLLRSLEAADLHPSVLEEAVLA
Download sequence
Identical sequences A0A087Y8C6
XP_007541313.1.10163 XP_014878559.1.100837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]