SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087Y9A0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087Y9A0
Domain Number 1 Region: 92-193
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-21
Family C-type lectin domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087Y9A0
Sequence length 236
Comment (tr|A0A087Y9A0|A0A087Y9A0_POEFO) Uncharacterized protein {ECO:0000313|Ensembl:ENSPFOP00000014603} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MVDLLCISRRASFHFHFTVIGQWEFFIEHTGCKMTSLEEKTVTVTSPCCSSTKFLVVLGE
NMPQKSCIFILLHLLFPSACGQLPDLRHRIIQQYNEQKSWSEVQSICRYKHTDLIIIRNE
EENQALDGRQGWIGLYQDDNMSPWKWSSGDEIATFLNWDVGEPDLDQKCAYKAAITSSGR
DDICEFRRFYICYGERLVLVKESKTWEEALEHCRSLHNINSFDLATLITPDDHDFA
Download sequence
Identical sequences A0A087Y9A0
XP_007568350.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]