SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087YEW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087YEW7
Domain Number 1 Region: 849-933
Classification Level Classification E-value
Superfamily DEATH domain 2.28e-22
Family DEATH domain, DD 0.0000313
Further Details:      
 
Domain Number 2 Region: 155-246
Classification Level Classification E-value
Superfamily Immunoglobulin 3.32e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 245-296
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000068
Family TSP-1 type 1 repeat 0.00082
Further Details:      
 
Domain Number 4 Region: 299-353
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000085
Family TSP-1 type 1 repeat 0.00068
Further Details:      
 
Domain Number 5 Region: 48-149
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000318
Family I set domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087YEW7
Sequence length 939
Comment (tr|A0A087YEW7|A0A087YEW7_POEFO) Unc-5 netrin receptor B {ECO:0000313|Ensembl:ENSPFOP00000016570} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
LYPQSVANHFHVLKQVFCWKPRISESSDYSEAEVLPDSFPSAPAEPLPEFLLEPEDAFIV
KNRPVQLRCRASPATQIYFKCNGEWVNQNDHVTRESLDQLTGLVVREVDISVSRTQVEEL
FGLEDYWCQCVAWSSAGTTKSNCAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGM
PAAEVDWLKNEDVIDPSQDPNFLITIDHDLIIKQARLSDTANYTCVARNVVARRRSSTAT
LIVYVSGGWSSWTEWSECNARCGRGWQRRTRSCTNPAPLNGGIFCEGPQVQRITCTTLCP
VDGGWTEWAKWSACGTECTHWRSRECQAPPPINGGKHCSGSMMESKNCTEGLCARNKKVS
IEHASHPLSPGMGVAVYTGLVVALLLTVVMALGVGVLAYRRRCRHLHGDITDSSSALTAA
FHPGNYKPPRQDNPLHPSAPPDLTATAGAFRGPLFSLPQGINDSPHKIPMTTSPLLDPLP
SLKIKVYNSSTLSSLELPADMGVGDGEILSLKSVGTVGREREFHSHTLSREPGLSTSATL
GHLGGRLTIPNTGVSLLVPPGTIPQGKFYEMYLIINKWDKTTLPSEGSQTVLSPVVSCGP
SSMLLNRPVVLTLPHCAQLDTPTPDWTLTLKTQTHQGAWEEVLTVGEETLSSPCYLQLEE
ECCHVLMEQLGTYGLVGQSCPPRPACKRLQLALFAPRAPCLSLDYSLRIYCIHDTPHALK
EVLDLERSLGGVLLEDPKPLFFKDSYHNLRLSIHDIPHNHWRSKLLAKYQEIPFYHIWSG
SQRPLHCTFSLERASLAVSQLACKICVRQVEGEGQIFQLHTDIQETLPPHSPLPSGSTCL
PSSQVGPYAFRLPDSIRQKICASLDAPSARGCDWRLLARSLGFDRYLNYFATKPSPTGVL
LDLWEACHQGDADLVSLATALEEMGKSEVLVVMTTDGDC
Download sequence
Identical sequences A0A087YEW7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]