SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087YEZ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A087YEZ9
Domain Number - Region: 115-149
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000105
Family HIT zinc finger 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087YEZ9
Sequence length 156
Comment (tr|A0A087YEZ9|A0A087YEZ9_POEFO) Zinc finger HIT-type containing 1 {ECO:0000313|Ensembl:ENSPFOP00000016602} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN=ZNHIT1 OC=Poeciliinae; Poecilia.
Sequence
MVLEKKSSARVEAGQRRVLDEATRQRRLTRQLEALEKDNFQDDPLSSLPPPGPTARLPAF
SETEEPEKKRRKTRGDHFKQRFRKNFTTLLEEENLSERAEPNYLSAAAPPSSLPPRLFCC
VCGFPSHYTCTTCGGRYCSSRCLLTHRETRCLKWTL
Download sequence
Identical sequences A0A087YEZ9 M3ZIP4
ENSPFOP00000016602 ENSXMAP00000002086 ENSXMAP00000002086 XP_007540840.1.10163 XP_014330051.1.87360 XP_014824556.1.96476 XP_014905677.1.100837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]