SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087YI80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087YI80
Domain Number 1 Region: 956-1170
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.09e-106
Family Thrombospondin C-terminal domain 0.00000000293
Further Details:      
 
Domain Number 2 Region: 28-231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.57e-36
Family Laminin G-like module 0.000000486
Further Details:      
 
Domain Number 3 Region: 833-954
Classification Level Classification E-value
Superfamily TSP type-3 repeat 3.4e-36
Family TSP type-3 repeat 0.000000291
Further Details:      
 
Domain Number 4 Region: 489-547
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 2.35e-16
Family TSP-1 type 1 repeat 0.0000651
Further Details:      
 
Domain Number 5 Region: 436-485
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000183
Family TSP-1 type 1 repeat 0.000096
Further Details:      
 
Domain Number 6 Region: 765-835
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000432
Family TSP type-3 repeat 0.00025
Further Details:      
 
Domain Number 7 Region: 692-776
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000049
Family TSP type-3 repeat 0.00011
Further Details:      
 
Domain Number 8 Region: 316-373
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000858
Family VWC domain 0.0037
Further Details:      
 
Domain Number 9 Region: 381-426
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000314
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 10 Region: 548-601
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000649
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087YI80
Sequence length 1171
Comment (tr|A0A087YI80|A0A087YI80_POEFO) Thrombospondin 1b {ECO:0000313|Ensembl:ENSPFOP00000017733} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MKVTGICLLLMLCSCDGARVAESRDDNSVFDLFELIRVPSKNHGVTLAKGDDPYSPAYKI
LNPDLIPPVPESAFRDLIDSVYVEKGFLLLLNFKQFKRTRGSLLTVEKRDGSGPVFEIVS
NGKANTLDIVYSTENKQQVVSIEEVDLATGGWKNITLFVQEDRAQLFAGCEEVNTVELEA
PIQNILTQGTAAGAQLRVGKGAVNDRFMGVLQNVRFVFGTTLDAILRNKGCQSTAPSETM
IVTNLNGSSAIRTEYTGHKTKDLQMVCGFSCEDLISMFKELKGLGVVVKELSNELRQLTN
ENKLIKNHTGLHSHRGVCIHNGILRKNKDEWTVDDCTECTCQNSATVCRKISCPLIPCAN
ATVPDGECCPRCGTPSDYAEDGWSPWSEWTHCSVSCGRGIQQRGRSCDRINNICEGTSVQ
TRDCYLQECDKRFKQDGNWSHWSPWSSCSVTCGSGVITRIRLCNSPTPQLGGRGCVGEGR
QTETCEKSPCPINGNWGPWSPWGTCTLTCGGGVQSRKRLCNDPAPLHGGKECVGDAIDRQ
MCNKKACPIDGCLSNPCFSGAKCSSFPDGSWKCGKCPVGFTGNGIKCKDVDECKEVPDAC
FEFNGVHRCENTEPGYNCLPCPPRYSGPQPFGKGVEQAAANKQVCTPRNPCLDGSHDCNK
NARCNYLGHFSDPMFRCECKPGYAGNGHICGEDTDLDGWPNADLVCVENATYHCKKDNCP
NLPNSGQEDYDKDGTGDACDDDDDNDGIPDDRDNCPFVYNPRQYDYDRDEVGDRCDNCPY
NSNPDQTDTDNNGEGDACAVDIDGDGILNEKDNCPYIYNVDQRDTDLDGVGDMCDNCPLE
HNPDQVDSDDDRVGDKCDSNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDHDDD
NDGIPDDKDNCRLAFNPDQLDSDGDGRGDACKDDFDQDNVPDIYDVCPENFDISETDFRK
FQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGYHEFNAVDFSGTFFINTERD
DDYAGFVFGYQSSSRFYVVMWKQITQTYWSSKPTKAQGYSGLSIKVVNSTTGPGEHLRNA
LWHTGNTAGQVRTLWHDPKNVGWKDFTAYRWHLIHRPRTGLIRVVMYEGKKIMADSGSIY
DKTYAGGRLGLFVFSQEMVYFSDLKYECRDA
Download sequence
Identical sequences A0A087YI80
XP_007541356.1.10163 XP_007541435.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]