SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087YIS0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087YIS0
Domain Number 1 Region: 8-155
Classification Level Classification E-value
Superfamily C-type lectin-like 2.41e-38
Family C-type lectin domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087YIS0
Sequence length 156
Comment (tr|A0A087YIS0|A0A087YIS0_POEFO) Uncharacterized protein {ECO:0000313|Ensembl:ENSPFOP00000017923} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MDSVLLCTLLLCGFGLGVAVTAVYKMCPAGWTRYRGDCYLYDDTELTWIQAELHCISNHG
NLATIQNQHQYTFLRSLIFKSAGTHKRTWVGGYDGVEEGTWLWSRGTKFDFTQWGPEEPN
DFEGNEDCMEINREGEDFVNDIRCGRENSFICVRRP
Download sequence
Identical sequences A0A087YIS0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]