SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087YKB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087YKB3
Domain Number 1 Region: 115-451
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-87
Family Protein kinases, catalytic subunit 0.00000000000991
Further Details:      
 
Domain Number 2 Region: 2-112
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.13e-26
Family Regulator of G-protein signaling, RGS 0.0000033
Further Details:      
 
Domain Number 3 Region: 482-604
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-22
Family Pleckstrin-homology domain (PH domain) 0.00000617
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087YKB3
Sequence length 629
Comment (tr|A0A087YKB3|A0A087YKB3_POEFO) G protein-coupled receptor kinase {ECO:0000256|RuleBase:RU000308} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MNEIDEAVPQLKFYEEIKEYEKLDSEDERLSRSRQIYDIYIMKELLSCSHPFSKKAVDHV
QSHLAKKMVPPTLFQPYIVEICDSLRGNIFQKFIESDKFTRFCQWKNVELNIHLTMNDFS
VHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVSTGDCP
FIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYAAEIILGLEHMHNRF
VVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPEVLQKGTAYDSSA
DWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMNVELPDSFTPELKDLLEGLLQRD
VSKRLGCQGRGALEVKEHQFFKGIDWQQVYLQKYPPPLIPPRGEVNAADAFDIGSFDEED
TKGIKLLDSDQELYKNFPLVISERWQQEVAETVYEAVNLDTDKIEARKRAKNKQLGHEED
YAFGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRVEWRGEGESREKWLKTLKMVKDRQN
LLTMEQIVSVEETQVKDKKCILLRVKGGKQFVLQCESDPEFVQWKKELNEAFTEAQKLLR
RAPKVIGKGRAAVVELSKPPLTHRNSNGL
Download sequence
Identical sequences A0A087YKB3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]