SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087YL97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087YL97
Domain Number 1 Region: 5-104
Classification Level Classification E-value
Superfamily Chaperone J-domain 7.98e-35
Family Chaperone J-domain 0.00019
Further Details:      
 
Domain Number 2 Region: 261-343
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 7.98e-23
Family HSP40/DnaJ peptide-binding domain 0.00076
Further Details:      
 
Domain Number 3 Region: 115-149,216-259
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.31e-17
Family HSP40/DnaJ peptide-binding domain 0.00061
Further Details:      
 
Domain Number 4 Region: 141-213
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 3.01e-17
Family DnaJ/Hsp40 cysteine-rich domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087YL97
Sequence length 412
Comment (tr|A0A087YL97|A0A087YL97_POEFO) DnaJ (Hsp40) homolog, subfamily A, member 2, like {ECO:0000313|Ensembl:ENSPFOP00000018800} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MANVADTRLYDILGVSPSASENELKKAYRKLAKEYHPDKNPDAGDKFKEISFAYEVLTNP
EKKELYDRYGEQGLREGGGGGPGMDDIFSHIFGGGLFGFMGGRGSRSNGGKRRGDDMVHP
LKVSLEDLYNGKTTKLQLSKNVLCSACNGQGGKAGAVQKCVACRGRGMKIMIRQLAPGMV
QQMQSVCTDCNGEGEVINEKDRCRKCEGQKVCKETKLLEVHVDKGMKHGQKITFSGEADQ
APGVEPGDIVLVLQEKDHEEFRRDGSDLHMVQRIGLVEALCGFQITITHLDGRQLLVKYP
PGKVIEPGCIRVVKGEGMPQYRNPFEKGDLYIKFDVQFPESNWISPEKLNDLENLLPARA
DNPDIAADAEEVDLAEFDRSQGSGSGGRREVYNDSSDDEGGHHGPGVQCAHQ
Download sequence
Identical sequences A0A087YL97
XP_007545750.1.10163 XP_014854274.1.96476 XP_014900219.1.100837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]