SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087YNN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087YNN1
Domain Number 1 Region: 1-195
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.05e-43
Family Calponin-homology domain, CH-domain 0.0000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087YNN1
Sequence length 202
Comment (tr|A0A087YNN1|A0A087YNN1_POEFO) Transgelin {ECO:0000256|RuleBase:RU361224} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MANRGPSYGLSREVQSKIDKKYDPELEERLVKWIIAQCGPGVKEPEKDKTGFQQWLKDGC
VLCELINSLHGANKPIKAIKTSSMAFKQMEQISMFLKAAESYGVIKTDMFQTVDLYESKD
LAAVQRTLLALGSLAVTKNDGNYKGDPNWFPKKSQENKRDFSEDQLNEGRNVIGLQMGTN
RGASQAGMTGYGRPRQIINPNP
Download sequence
Identical sequences A0A087YNN1
XP_007546080.1.10163 XP_014844731.1.96476 XP_014844732.1.96476 XP_014915043.1.100837 XP_014915044.1.100837 XP_016523863.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]