SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087YPJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087YPJ3
Domain Number 1 Region: 169-291
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.39e-38
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000113
Further Details:      
 
Domain Number 2 Region: 76-167
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.17e-25
Family Cold shock DNA-binding domain-like 0.00000958
Further Details:      
 
Domain Number 3 Region: 24-73
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000000022
Family ECR1 N-terminal domain-like 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087YPJ3
Sequence length 294
Comment (tr|A0A087YPJ3|A0A087YPJ3_POEFO) Exosome component 2 {ECO:0000313|Ensembl:ENSPFOP00000019946} KW=Complete proteome; Reference proteome OX=48698 OS=Poecilia formosa (Amazon molly) (Limia formosa). GN= OC=Poeciliinae; Poecilia.
Sequence
MAVDMRLPTVKNSMSLSHSAGDRKDLVVPGDVITSDTGFMRGHGTYVDEDKLTASVAGEV
QRVDKLICVRPLKTSRFNGEVGDVVVGRITEVQQKRWKVETNSRLDSVLLLSSVNLPGGE
LRRRSAEDELTMREYLQEGDLISAEVQSVFSDGALSLHTRSLKYGKLGQGVLVQLSPSLI
KRQKTHFHNLPCGASIILGNNGFVWLYPTPGQQEEEAGGFYTSLEPVSLSDREVISRLRN
CLLALAAHKVLLYDTSVLYCYESSLQHQVKDILKPEVMEEIVMLTQQKLLEHES
Download sequence
Identical sequences A0A087YPJ3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]