SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087ZMT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087ZMT3
Domain Number 1 Region: 207-273
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000122
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 2 Region: 155-213
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000249
Family TSP-1 type 1 repeat 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A087ZMT3
Sequence length 294
Comment (tr|A0A087ZMT3|A0A087ZMT3_APIME) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:GB40026-PA} KW=Complete proteome; Reference proteome OX=7460 OS=Apis mellifera (Honeybee). GN= OC=Apoidea; Apidae; Apis.
Sequence
MKTSFQEKNPRYWLQPCENPSDFRSEQCAAFDDVPYSGQLLKWYPHYDPSRPCALICRGE
QSVENTGNRLRQETSVEKTLPHDATDALQLDSEETIVVQLADKVEDGTKCYTDSMDVCIN
GECMKVGCDLRVGSNKNTDPCGVCGGNGSSCQSRYSWSLESISACSKSCGGGFKIAMAVC
KAIGPDESVVDDSYCDPDNRPEKTLMPCNTHPCTAKWVAGEWSMCSASCGGGSRTRTIFC
TEENGNETTKLPDHKCSNSRKPHNQETCNPISCPMWETNKWSEPMPSSRSFGTL
Download sequence
Identical sequences A0A087ZMT3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]