SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087ZT40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087ZT40
Domain Number 1 Region: 366-493
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.7e-42
Family Regulator of G-protein signaling, RGS 0.0000252
Further Details:      
 
Domain Number 2 Region: 69-174
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.53e-29
Family DEP domain 0.0077
Further Details:      
 
Domain Number 3 Region: 292-353
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000000000000249
Family Transducin (heterotrimeric G protein), gamma chain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A087ZT40
Sequence length 519
Comment (tr|A0A087ZT40|A0A087ZT40_APIME) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:GB41985-PA} KW=Complete proteome; Reference proteome OX=7460 OS=Apis mellifera (Honeybee). GN=LOC409912 OC=Apoidea; Apidae; Apis.
Sequence
MVTMNSEQSACRRKPSENSKIGGTVDRYRNRDNQINQCNNQNGQAVDKSPISPTYHITAS
CAEDTPNYLVYQKMEAIVEKMSDESTGVPVKTVKNFMTKTPSVFTGTDLISWMMKTMAID
DQEALHVAHLMASHGYFFPIDDHCLTVKNDNTFYRFQTPYFWPSNCWEPENTDYAVYLCK
RTMQNKTRLELADYEAENLAKLQKMFSRKWEFIFMQAEAQSKVDKKRDKLERKVLDSQER
AFWDVYRPMPGCVNTTEMDIKKACRTYKPFPKLSKHLQLEMANTDIPSHSESYTVSSLET
LNKEIEILKARLDRSNIKVSKVSEALIAYFEQYIEYDPFFIQPEFTNPWISDNSEMWEQE
KLAKEISTRRVKRWGFSLQELLQDPIGREQFIRFLDKEFSSENLKFWEAVQELKTLPQKE
VKNKVNEIWNEYLGPDASCPINVDSQSYEITKKHLQKPDRWCFDITAAHVYHLMKSDSYS
RYLRSEMYKDFLSGSKKKTSVKGIRSIVSFSGRRDTATS
Download sequence
Identical sequences A0A087ZT40
XP_393403.3.77095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]