SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A087ZT59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A087ZT59
Domain Number 1 Region: 273-474
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.42e-44
Family Reprolysin-like 0.00061
Further Details:      
 
Domain Number 2 Region: 572-628
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000732
Family TSP-1 type 1 repeat 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A087ZT59
Sequence length 708
Comment (tr|A0A087ZT59|A0A087ZT59_APIME) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:GB42004-PA} KW=Complete proteome; Reference proteome OX=7460 OS=Apis mellifera (Honeybee). GN=LOC551407 OC=Apoidea; Apidae; Apis.
Sequence
MTQSKLPSFLLTTWLLLGTIATKSRMGEFLHSLQEYEIVYPRVISNENGRGRRSTRESLE
PMLLEISNWTLRTVVNDRFLFSSNFTVDWVKRGKRRLEDHEKARCDLRRGSLEGDESSFV
VVTICEEDVYAMMLTNQRSFFVQPLTNGEHVMFQSKQAKWWSTRENLGDDVIVAEKSRKE
RKDKKSKRRRRESLNHDVQTFYNLSGDIFDVEYPEAEKLILYDEKDEISAEYNDTSVEEL
PTDVNSEEIGHFSGPKWQRNKISKRKQGSKESPPRWLELGIAADYSVIDFHGIRVQQYIL
ALLNIVSAIYMDPSLDSNMVLVIVRMILYAEKRDGMVRRGDAKRSLENVNKWNRKMLSSA
DVNHDVAVWLTRLDIGGPSGYAPVSGVCDPSRSCALNRDEGLTSAFIIAHEVAHILGLTH
DGDEMTGNACKEEGSRGSVMAPMVAATFHHFYWSACSKKEFHRRVRRWSCLLNKPRHDSL
GQLRTTVRETFTMDEQCRMEFGEGYEHCKTFDIEEPCSRLWCGNSNISESCKTKKGPPLE
GTLCGTSKWCIKGRCVSTNRKNFDFGVILNKPRNGGWSGWASWSKCSRSCGVGVQCRTRK
CNKPLPAYGGKYCSGPSDDCRVCDLPMCLTSIDLRAQQCTKLANILYLERFDSTRDVTWL
PHASNQENLRCRLVCRSKETDEIFYTRKHLIDGTPCSYGSTDICIQVR
Download sequence
Identical sequences A0A087ZT59
XP_623804.2.77095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]