SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088A0N6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088A0N6
Domain Number 1 Region: 327-478
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.73e-16
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 2 Region: 45-103
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000157
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 3 Region: 176-225
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000562
Family TSP-1 type 1 repeat 0.00069
Further Details:      
 
Domain Number 4 Region: 235-288
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000235
Family TSP-1 type 1 repeat 0.00073
Further Details:      
 
Domain Number 5 Region: 290-329
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000288
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 6 Region: 523-666
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000373
Family Laminin G-like module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A088A0N6
Sequence length 783
Comment (tr|A0A088A0N6|A0A088A0N6_APIME) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:GB44766-PA} KW=Complete proteome; Reference proteome OX=7460 OS=Apis mellifera (Honeybee). GN= OC=Apoidea; Apidae; Apis.
Sequence
MKIWPSTIILFIFVTSLIFLVFTDDVSNAMQNLYCDLGLKSEELCPIDGEWSSWSSWESC
SGKCGFKGKKIRHRICNNPIPSNNGAPCIGPNYQIESCHITGCTMNDYEKIVNIYPIRKE
ELEIVKDIHKKLPALIELCFLADCTFSIVEKILGNNSMLYWNAMNCIKYNVGCPNPGGWS
AWGIWSSCTAICGKGLKYRTRICNSPIPSNYKLICHDSALETKNCLGLNCRKLSTGTWSN
WSKWTMCSVECGSGIRTRKRSCSEIQNLQGTSCKGVSKEIKGCTINNCSINGMWSSWTIW
SSCTSSCGIGTQLRNRMCNNPSPNVKSHEIADFTEESYLFYETTGRPSRLLHIYLRFLPL
SPFGMIIYRFEKNCKGLICDFVKLFLQNGKIVLLSQIADCTLALIHETKMEIGQWHVVLI
AIYGTHGILRIDDGLHKINTFSCIPMSYDLDHVMKIGGFQGQIQEVAINFAPVQLRALKD
TYNKKYANILSSSNNVQYLLGDDNEGFIYIGLTDSIAVPCPKCIEYWQITIAIKIENING
IVAIITDDSLNKYILLLIEEGKIKLKFYQGATYVTIESIEHISIREWFEIIVAYDSKNVY
MQVNGNEKKYIPLGFEEIIIISVTDIFLGAIRDNIREKICSECADVPQMSFTLGYFNING
EEIDLITLSILETSSKRFSSRTISISDYYQEVSIFLGQELKLSCFYDTIPHEKRHIFSKQ
TYATWILMDKLLLSYGNKYGFYRLPQIISNSTSIINFVLSKNGVTLLGSQQAANEVVSKI
LND
Download sequence
Identical sequences A0A088A0N6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]