SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088A367 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088A367
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.67e-38
Family Transglutaminase core 0.0000458
Further Details:      
 
Domain Number 2 Region: 137-250
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.02e-31
Family Transglutaminase, two C-terminal domains 0.0019
Further Details:      
 
Domain Number 3 Region: 251-350
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.15e-25
Family Transglutaminase, two C-terminal domains 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A088A367
Sequence length 354
Comment (tr|A0A088A367|A0A088A367_APIME) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:GB45708-PA} KW=Complete proteome; Reference proteome OX=7460 OS=Apis mellifera (Honeybee). GN= OC=Apoidea; Apidae; Apis.
Sequence
MKRDDISAEYSGWQAIDATPQELSENAYRCGPASVIGVKRGDVLRPYDNAFVFAEVNADI
VFWRYNGPTQPLKLIQKDAYGIGQLISTKAVGKWTREDITHTYKYPEKSEEERATMLKAL
RQSQSLFSRYYLNDEFNDVTFDFELRDDIVIGQPFSVVLSIKNRSDRNEYEVSVILRVET
VLYTGRVGDPVKRWSVNRVVMPRTVEEARMDVSWQEYGPRLLDQCAFNVACLATVKDTNF
EYFAQDDFRVRKPDIAIRLENEAVVGDELKATARFQNPLPIPLNKGRFLIEGPGLDEQLK
VKLPDPVRTGAYAECSFSMVPRYEGRATIAAKFYSNELEDVDGFVNFMVKRNGD
Download sequence
Identical sequences A0A088A367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]