SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088A5Y3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088A5Y3
Domain Number 1 Region: 156-283
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.4e-43
Family Regulator of G-protein signaling, RGS 0.00000438
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A088A5Y3
Sequence length 306
Comment (tr|A0A088A5Y3|A0A088A5Y3_APIME) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:GB46720-PA} KW=Complete proteome; Reference proteome OX=7460 OS=Apis mellifera (Honeybee). GN=LOC726284 OC=Apoidea; Apidae; Apis.
Sequence
MIEMSSGIGATAMGIGVSHGTGGGEGVPGGCRLRAQSQGQASCSSANSQQSSQQQQQQQQ
QQQQPPPSSQQPQQQQQRQPSGIMGRSKKENCCWWCCCCSCSWDKCLEAVGGSTGGAGGA
GDQGKKKGNAGVGEHGFGSELCDAGNGLEGLDTECSLEEIRSWGSSFDKLMKSQAGRKFF
REFLLSEYSDENIAFWLACEQLKRESNSEKIEENARYIYDRYISTVSEKEVSLDSRVREI
VNRNMVQPTPHTFDEAQLQIYTLMHRDSYPRFVNSELYRRVARLGCSGEAGNQEQGKSKA
RKGTAT
Download sequence
Identical sequences A0A088A5Y3
XP_006562180.1.77095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]