SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088AFH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088AFH5
Domain Number 1 Region: 36-472
Classification Level Classification E-value
Superfamily Sema domain 7.19e-125
Family Sema domain 0.000000469
Further Details:      
 
Domain Number 2 Region: 594-644
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000157
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 3 Region: 663-717
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000209
Family TSP-1 type 1 repeat 0.00071
Further Details:      
 
Domain Number 4 Region: 796-843
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000811
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 5 Region: 853-902
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000017
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 6 Region: 468-518
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000011
Family Plexin repeat 0.0039
Further Details:      
 
Domain Number 7 Region: 907-948
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000353
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A088AFH5
Sequence length 1089
Comment (tr|A0A088AFH5|A0A088AFH5_APIME) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:GB50224-PA} KW=Complete proteome; Reference proteome OX=7460 OS=Apis mellifera (Honeybee). GN= OC=Apoidea; Apidae; Apis.
Sequence
MERWSARLAILCTVIASVRSTDDFRRIAYEDLANTSLFQQEGVTSYSQLLFDVARQQVVV
GARDNLYRLTLTSLSPLEHASWPAPENKTNTCQNKGQSVEDCRNYVKVLLTNGKSLFTCG
TYAFSPWCTWREIENISSVTSEMSGVAMSPYSPHANVTALLARGPTGGLFTGAPTDFSGS
DPAICRTLASPNLRTHQYDSRWLNDPQFVGSFETEDHVYFLFRESAVEYINCGKKIYSRI
ARVCKNDRGGQIMMREVWTTFSKARLNCSLPGEFPFYYDEIQGAVYHPEEKIVYATFTTP
INGIAGSAICAFNMSAITASFNGPFKHQENSGAAWERRPVSHHNRQRCGSFANVAPHQII
DNQRYQLMDDAVQSTTLEPLHTALLERFTLIALDVTPTKLHRSVTVLYVATDVGLLKKIS
VLPRTQETCIVEVWGPLPSTPITLQFLKDTQSLYVGTEFGLLRIPAAQCHRHRTRQSCLN
AQEPYCGWNEHLMKCAPAPKQNHLANHWHQEVTKCPVLTDPVDGGWSAWSSWSPCQHGTA
EHSHSHSHSHLHSEHAEAPADICQCQTRDCNNPPPQHGGAPCTGARVRVTNCTVHGEWTA
WSAWSACSQTCGFAMKTRRRTCTNPAPAFGGRVCVGHDHDDNICIDLPPCPAKDEAPPPE
SFGQWSPWGGWNACSRPCNGGIRIRRRTCENPSPRKSATVECNGCDTQTEECNTHPCIET
KRYSGWTPWLAANGSFQSSSVGYVEKRFRFSCRAQTDDPSSVRVQLAKEEERYCRNDGSC
MRRNANQKSYSDLAMESGWGEWSAWKTCDRLCGGGSQHRIRQCESPPCDGLPVQTRQCNV
HSCRPSAVGDIAMEGQWSCWTDWSECSVSCGVGIRSRTRECLGPESCEGSSLVRETCEMA
SCESLIGWDTWSRWTPCDNDHQQYRKRQCLQHGSGMCQGASRETRDCLPDCSGNEVNALW
SMERSGITIGAVVGSCVVSFLVGLAVTAILSFYYLKRRQQRIPGSPHYISKQNSYVTVPM
KEVNTKRQPSFSGSTNGNGTLRGKNNPNVNTLGSPKLYPKSLDYESATLKRNSHGQQHIR
VDPDQDKYY
Download sequence
Identical sequences A0A088AFH5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]