SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088API2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088API2
Domain Number 1 Region: 145-359
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.24e-34
Family Reprolysin-like 0.0023
Further Details:      
 
Domain Number 2 Region: 444-500
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000536
Family TSP-1 type 1 repeat 0.00044
Further Details:      
 
Domain Number 3 Region: 727-782
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000235
Family TSP-1 type 1 repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A088API2
Sequence length 1011
Comment (tr|A0A088API2|A0A088API2_APIME) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:GB53530-PA} KW=Complete proteome; Reference proteome OX=7460 OS=Apis mellifera (Honeybee). GN= OC=Apoidea; Apidae; Apis.
Sequence
MQRTFRDWSTGAVIEEHRRPAGGGGVRNSDDNLLKDAKLREMRDSQCHYLGRVHGHSGDS
ALSTCYGLAGFIRTKRSWYTIEPVAGHDFTKETEHPHVVYKKRPHEFGRNAEILCNVTGN
MAKTIAKRAFSSQKRHPPKNQANSYTMELLLVLDKTVLDYHKDFDVENYALTLLNMAAAL
LHDVSLGINMELTIVRIIRMLVQENEMSLTITKDTNATLKYFQKWQRMINPGDDTHPNHH
DCAILITKSNICDSPSVCGFTGTSTIAGTCDPLKGAAIINDVGLHTGYHIAHHLGHTLGM
SHDVKEENGCPGIIHHENYIETTVMHPGNLYITRKWSVCSKESLRLYIETDLGFCLVDKQ
QNYEFPSTELLPGVMYNADDQCRIEYGLEARHCDLEVKCESLRCAIPGKGCVSTMEPVAD
GTRCGENRWCYGMKCLLVGERPGVVDGGWSNWSPWSRCSRTCGSGVTLSVRRCVNPVPSN
GGAFCRGDRKRHKICTTEPCDVGAPSFRDVQCSGYNNWIFPEDGKLHQWSEYKLPEDLRI
SENPCTLYCVNEKNVVASLNPRVVDGTTCYRGIRNICIGGICREIPCDLNMESNAIEDAC
GVCKGNGTSCSLKSYTTTIVQASRPTKLVEIPLDATNVRVEEMEPSKSRIMVWSKDEKPL
IRGDRLGLYEIAGMKAWLGAIRLNQETLVIPGPIFEELIILILPKENVTVRYSFGVREKS
PRKPEFSWNFLDWEECNANCGPGEQISKPRCLEKHAGLVDDTFCKSMARPQEKVRPCYRA
PCVPRWVLGDWQGCTSCTFRCENTRSVKCVRPVGHSEQDVDIIADSYCEGPKPKEREPCA
GREKRSNDNIPTTRSKRWQKDSDEKKLRIKRKHEEEEDDDDDDDDDEEEEERHEEEEEER
EEEEEEREEEEEEREEEEEEEEEKEEKKEEEDRLRIQQIKKGEEVIDSKDVHNLTLNIIL
EHDATGALIFPKDFVPQPPSNSTVFTLVGMDAVKYIQKIQEDAVTPSKRHS
Download sequence
Identical sequences A0A088API2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]