SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088APL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088APL6
Domain Number 1 Region: 260-473
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.36e-50
Family Reprolysin-like 0.0023
Further Details:      
 
Domain Number 2 Region: 562-618
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000445
Family TSP-1 type 1 repeat 0.00044
Further Details:      
 
Domain Number 3 Region: 846-904
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000301
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number 4 Region: 907-964
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000719
Family TSP-1 type 1 repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A088APL6
Sequence length 1151
Comment (tr|A0A088APL6|A0A088APL6_APIME) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:GB53570-PA} KW=Complete proteome; Reference proteome OX=7460 OS=Apis mellifera (Honeybee). GN=LOC412887 OC=Apoidea; Apidae; Apis.
Sequence
MNRFLALLTFQTLLTFPEIADSSNNNGHGKNLYHGRYSRNIHQPEFLIPRRVHEDGTFYS
YELPNFYDRHEVSQRKKRSIEDGGKQESVDNMDKLHLVLPFNGIEHHVELTPYHEFISPE
MVIETRGAGLRTDLDKALRFKRAPDQQCHYRGFVRGHDTSRAAISLCDGVVGYVQTDHGR
YFIEPAIETEPKEDGQHVHIAYKRGPTTKDEVPKKKHCGTSDKWEEEWAKQLARREKEIM
EEGERKKRKEAKEPPYGHSIHRYMEIAVVADRKFLDFYNSSNFEQYLLTIMNIAADYYHD
KSVGNQIDLVIVRMIYLEKEKEEIDLSISPNAEDTLASFAAWADKLNPEDTDHPNHFDIG
VLVTRYDICSDNLTNCDLLGLAYLATACDRKKAAAICEDTGLNLGITVAHEVGHVMGCSH
DTMEISGCEPQDKDESYFIMSPYVNPFTLRWSPCSRRFITNLIEGKLGDCLIDDPKNPPD
KFKLPDMLAGAMYGADFQCDMQYPGSKMCTSHATKMCEQLWCQVNETTCMSNGAQSADGT
KCGEKKWCIHKLCVDMGARPAAVHGGWGKWGPMSACSRTCGGGLKYAERECDNPQPANKG
KYCIGERKKLTICNTNPCDPKRPSYRMMQCASYNDKMPLSDNKLHNWTAHMSKNLDPCIL
YCLNEENSFVILQKMVNDSTPCKAGTNNMCVAGLCRKVGCDWVFDSDAIEDKCGVCKGDG
TKCKPVEGVYNETKITSQIMKIVTIPKGARSISVKEMGPHPNYLAVKVSNTNNYCLNKDF
VIERAGDYECANSILMYIRPDKNLEEIFIKGPISEDLEFQYLMLQGKILGVHYLYYVMTT
DTTYKPKYLWDFTEWSECSVRCAGGTMISQPTCIEQYGGKVVSSFCNGIPRPEPKTRVCN
THACPAKWRVSQWSKCSACDGKKGTRHRKVQCVRPAPIAGQDDIQANLDACKGRVPKQKE
ECVGKRPCKKLCAKKPRDTELAAKEKKQTILPAEEQGRLIDKAVDLSLARYLERAYGVPR
EISELESGIGIADFRQLLREWSLAEEGKRKRATSCVNDFPTPKPGAIIKDALPVEKVMVM
QAPLIVEDLQANLSDLAYQQIGDMSIGGGLDTSRIKVFNGTQAYKVMEEMEGITRPPDFK
PWKNSTLNSSS
Download sequence
Identical sequences A0A088APL6
XP_016768026.1.77095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]