SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088BYF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088BYF6
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 2.24e-62
Family Immunodeficiency virus matrix proteins 0.00000243
Further Details:      
 
Domain Number 2 Region: 126-150
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 0.00000000863
Family Retrovirus capsid protein, N-terminal core domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A088BYF6
Sequence length 150
Comment (tr|A0A088BYF6|A0A088BYF6_9HIV1) Gag protein {ECO:0000313|EMBL:AHI62091.1} OX=11676 OS=Human immunodeficiency virus 1. GN=gag OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
MGARASILRGEKLDKWEKIRLRPGGKKRYMLKHLVWASRELEKFALNPGLLETAEGCKQI
IKQLQPALQTGTEELKSLFNTVATLYCVHSGIGIRDTKEALDKIEEEQNKIQQVKEADGK
GKVSQNYPIVQNLQGQMVHQPISPRTLNAW
Download sequence
Identical sequences A0A088BYF6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]