SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088CRW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088CRW4
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000778
Family Group I mobile intron endonuclease 0.071
Further Details:      
 
Domain Number 2 Region: 76-166
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000218
Family Group I mobile intron endonuclease 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A088CRW4
Sequence length 176
Comment (tr|A0A088CRW4|A0A088CRW4_9HELO) LAGLIDADG endonuclease {ECO:0000313|EMBL:AIJ56820.1} OX=77105 OS=Sclerotinia borealis. GN=SBORM_0128 OC=Helotiales; Sclerotiniaceae; Sclerotinia.
Sequence
MYAFIQSELGNVGRFQITGENILRYVIGDKAGIMLFINLTHGKLRTPKNKRFNDLIKVFN
VKYSLDISESLLDNSDFTNNSWFTGFTEADGHFGIKYVESKAKSDTRKRSVSENISLKFR
LDQRSYDKPTSSSMKPFMESLALFLSCNLKDYTNNKGLEALSLSVLSIDPPPPLTK
Download sequence
Identical sequences A0A088CRW4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]