SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088MME8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088MME8
Domain Number 1 Region: 4-32
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0000000000275
Family Fibrinogen C-terminal domain-like 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A088MME8
Sequence length 32
Comment (tr|A0A088MME8|A0A088MME8_EULJU) Beta-fibrinogen {ECO:0000313|EMBL:AIN42651.1} OX=190444 OS=Eulampis jugularis (Purple-throated carib). GN= OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Eulampis.
Sequence
LTTDPRKQCSKEDGGGWWYNRCHSANPNGRYY
Download sequence
Identical sequences A0A088MME8 A0A088MMF9 A0A088MMH9 A0A088MMI3 A0A088MMI5 A0A088MMX0 A0A088MR32 A0A088MZW6 A0A088N022 B5SSG1 D2JZ90 D2JZA6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]