SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088NUY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088NUY8
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.02e-45
Family SMI1/KNR4-like 0.000000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A088NUY8
Sequence length 135
Comment (tr|A0A088NUY8|A0A088NUY8_9PSED) Cell wall assembly protein {ECO:0000313|EMBL:AIN61022.1} KW=Complete proteome OX=1388763 OS=Pseudomonas mosselii SJ10. GN=O165_022930 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MEEVIEQLREANEPVPVPLELPDEDQLVEIEEELFINIPFVFKEYLLTVSDVVYGSLEPV
TVTDPQSHTYLPEVAANAWDAGVPRDLIPICQDGDDFYCVEEDGTVVLWSGEEEIVTEES
WESVWHWARDVWLES
Download sequence
Identical sequences A0A088NUY8 A0A0F7Y5Z5 A0A1H9HH01
WP_023629684.1.17606 WP_023629684.1.3973 WP_023629684.1.83237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]