SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088NY97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A088NY97
Domain Number - Region: 30-58
Classification Level Classification E-value
Superfamily Stathmin 0.0248
Family Stathmin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A088NY97
Sequence length 109
Comment (tr|A0A088NY97|A0A088NY97_9PSED) Uncharacterized protein {ECO:0000313|EMBL:AIN57989.1} KW=Complete proteome OX=1388763 OS=Pseudomonas mosselii SJ10. GN=O165_006665 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSGSGKAIGAALVLVGAAIGWVSRGFKDKGEKEKLKDVAERRGHDLETVLKTFEVEASRM
EKIITAISTENPSSATELTALLKKYGLNQLQITKIVSTRFPETTQSGAA
Download sequence
Identical sequences A0A088NY97
WP_023629521.1.17606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]