SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088QED4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088QED4
Domain Number 1 Region: 141-252
Classification Level Classification E-value
Superfamily Sortase 0.00000196
Family Sortase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A088QED4
Sequence length 255
Comment (tr|A0A088QED4|A0A088QED4_9CORY) Sortase family protein {ECO:0000313|EMBL:AIN81797.1} KW=Complete proteome; Reference proteome OX=1487956 OS=Corynebacterium sp. ATCC 6931. GN=DR71_1245 OC=Corynebacterium.
Sequence
MTDQFGSDEAGQEPGNAPGYEPGIEPETDTGALDHVDAFDQDEDQADGHVEDLQDVPWWK
QPRMYIAAIALIGVIALLVIGQLNRNDSALEGAQENLPTPAQGSRGAVHEMEMLIDGKSA
PIDFVQLTDQGSLIPPTDVSRLGWYSASAIPGEEGAAGSSVITGHVNEVDQGDGYAARFA
DLRAGDTVTVKVDGESRDFTVSHDPIQVVKGARMPEAVNDAVGENRLVLITCGGEFVGGT
LGYADNIIVEATPVR
Download sequence
Identical sequences A0A088QED4
WP_038627376.1.13194 WP_038627376.1.13973 WP_038627376.1.37694 WP_038627376.1.53732 WP_038627376.1.8637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]