SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088RBS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088RBS3
Domain Number 1 Region: 29-85,120-193
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.35e-19
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A088RBS3
Sequence length 195
Comment (tr|A0A088RBS3|A0A088RBS3_9SPIO) SMI1 / KNR4 family protein {ECO:0000313|EMBL:AIN93232.1} KW=Complete proteome OX=221027 OS=Treponema putidum. GN=JO40_03080 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Treponema.
Sequence
MQLIDKIKQIEKYICEHFEEWDLDDPVEEEYLDDYQEISGASEEELSVFEKKFSITLPED
FKELYRYKNGSKYLSIFPCVIDEIEMPFNLMSLQAVTNTKEHFQNRDALLTEFTDYFTNE
DIENMKDSRIKPYLFNKKWIPFAEYCDSCFLMLDFDPDTTGKEGQIICYIHDPDKVVYTA
PSITELIDGIIAEID
Download sequence
Identical sequences A0A088RBS3
WP_044977834.1.90305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]