SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A088RJA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A088RJA9
Domain Number 1 Region: 7-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000107
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A088RJA9
Sequence length 161
Comment (tr|A0A088RJA9|A0A088RJA9_9TRYP) Uncharacterized protein {ECO:0000313|EMBL:AIN96067.1} KW=Complete proteome OX=5679 OS=Leishmania panamensis. GN=LPMP_091540 OC=Leishmaniinae; Leishmania; Leishmania guyanensis species complex.
Sequence
MNAMYSADQINVPPELGTIMKQYTKAVMRDKPTDLYKYSANFFAILSGYATPFDAEGQLT
ENGVSEVPSCSADPVPVEIQEEESADSQDPVDAILRRYDRTGTGYMDPAELPQLLADLRT
SLSLDEKDLDSVEDILAVLPSAHNQIDLLGLRSFLFEGVGE
Download sequence
Identical sequences A0A088RJA9
XP_010704389.1.42505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]